Page 77 - IMO-1-1

Innovative Medicines & Omics Smp43 peptide

Previous studies on this complex mixture have antibiotic-resistant strains, by rupturing bacterial
revealed a wealth of physiologically active substances membranes and disrupting intracellular functions. Smp43
with potential medical uses. Peptides, one of the many may thus be a valuable asset in the ongoing fight against
constituents of scorpion venom, have drawn particular antibiotic resistance. 5
attention due to their wide range of biological activity Smp43’s antiviral potential is also noteworthy. It has
and therapeutic potential. The pharmacological effects of demonstrated broad-spectrum antiviral activity and the
scorpion venom peptides (SVPs) are diverse, including ability to modulate host immunological responses. In an era
antibacterial, antiviral, anticancer, anti-inflammatory, and where viral threats are increasing, and traditional antiviral
analgesic actions. These peptides are valuable candidates therapies are becoming less effective, this potential is
for drug discovery, as they frequently work by targeting particularly valuable. In addition, Smp43 holds therapeutic
specific biochemical pathways. In the battle against potential in cancer treatment. It induces reactive oxygen
infectious diseases, the antibacterial properties of SVPs species (ROS), triggers autophagy and apoptosis, and
have attracted substantial interest. These peptides have modulates both pro- and anti-apoptotic proteins, thereby
the ability to disrupt cell membranes, inhibit essential activating apoptotic pathways. Furthermore, Smp43
enzymes, or modulate immune responses to target a wide influences key signaling pathways that regulate cell growth,
range of pathogens, including bacteria, fungi, and viruses. survival, metabolism, and autophagy, such as PI3K/AKT/
The growing prevalence of antibiotic-resistant bacteria mTOR, JAK/STAT, NF-κB, and ERK/MAPK. These
has increased the need for novel antimicrobial agents, attributes underscore its potential for treating a range of
and peptides found in scorpion venom offer a viable path cancers and metabolic diseases. In this review, we focus
6
toward the development of new therapies. 2 on the multifunctional properties of the Smp43 peptide,
Peptides found in scorpion venom have demonstrated as illustrated in Figure 1, including anti-inflammatory,
potential as anticancer agents in addition to their antioxidant, antibacterial, antiviral, and anti-cancer
antibacterial characteristics. They have the ability to disrupt activities.
cancer cell metabolic and signaling pathways, induce 2. Functions of Smp43 peptide in different
apoptosis, and inhibit cell division. These peptides provide
a targeted approach to cancer therapy with potentially biological systems
fewer adverse effects than traditional chemotherapy, as 2.1. Antioxidant and anti-inflammatory potential
they preferentially target cancer cells while sparing healthy Smp43 has the ability to neutralize both reactive nitrogen
organs. The analgesic and anti-inflammatory properties species and ROS. These reactive chemicals can induce
of SVPs also hold promise for therapeutic applications. oxidative stress, leading to cellular damage through
By modulating immune responses and inhibiting pro- lipid peroxidation, DNA damage, and protein oxidation.
inflammatory cytokines, these peptides can alleviate The presence of Smp43 may enhance the function of
symptoms of chronic inflammatory disorders such as endogenous antioxidant enzymes, including glutathione
arthritis, asthma, and neurodegenerative diseases. Their peroxidase, catalase, and superoxide dismutase, which are
analgesic properties also offer potential pain relief, essential for maintaining redox equilibrium and detoxifying
particularly for conditions that are not effectively treated ROS. By preventing oxidative stress, Smp43 helps protect
by conventional medicine. 3
Among the most promising peptides found in
scorpion venom is Smp43, which has the sequence
GVWDWIKKTAGKIWNSEPVKALKSQALNAAKNF
4
VAEKIGATPS. Isolated from the venom of the scorpion
Scorpio maurus palmatus, Smp43 is notable for its diverse
biological functions. Due to its strong anti-inflammatory
and antioxidant properties, Smp43 may be used to
treat conditions involving oxidative stress and chronic
inflammation. Its capacity to scavenge free radicals and
suppress pro-inflammatory cytokines makes it a valuable
tool in managing disorders characterized by these
pathological processes. Smp43 also demonstrates broad-
spectrum antibacterial action, effectively targeting both
Gram-positive and Gram-negative bacteria, including Figure 1. Functions of the Smp43 peptide in biological systems

Volume 1 Issue 1 (2024) 71 doi: 10.36922/imo.4353